@misc{singer2026reliftdense3dtracking,
  title = {ReLift: Dense 3D Tracking as Lifted Trajectory Repair},
  author = {Assaf Singer and Maroun Khriesh and Noam Rotstein and Yoni Kasten and Or Litany},
  year = {2026},
  venue = {Preprint},
  eprint = {2610.42136},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2610.42136},
  image = {./OL_files/relift_teaser.mp4},
  paper = {https://arxiv.org/abs/2610.42136},
  code = {https://github.com/ReLift3D/ReLift},
  page = {https://relift3d.github.io/},
  tweet = {https://x.com/assaf_singer/status/2117141154026201529?a=e3G98sEAP-UfbJYPh2Y&s=20}
}

@misc{mann2026videomdm3dhumanmotion,
  title = {VideoMDM: Towards 3D Human Motion Generation From 2D Supervision},
  author = {Amir Mann and Gal Michael Harari and Merav Keidar and Or Litany},
  year = {2026},
  venue = {NeurIPS 2026},
  eprint = {2606.13364},
  archiveprefix = {arXiv},
  primaryclass = {cs.LG},
  url = {https://arxiv.org/abs/2606.13364},
  image = {./OL_files/videomdm_method.png},
  paper = {https://arxiv.org/abs/2606.13364},
  page = {https://videomdm.github.io/},
  tweet = {https://x.com/orlitany/status/2065344454798500325?s=20}
}

@misc{shor2026learnablespectralactivations,
  title = {Learnable Spectral Activations},
  author = {Tamir Shor and Or Litany and Alex Bronstein},
  year = {2026},
  venue = {NeurIPS 2026},
  eprint = {2610.07419},
  archiveprefix = {arXiv},
  primaryclass = {cs.LG},
  url = {https://arxiv.org/abs/2610.07419},
  image = {./OL_files/lsa_teaser.webp},
  paper = {https://arxiv.org/abs/2610.07419},
  code = {https://github.com/tamirshor7/Learnable-Spectral-Activations},
  tweet = {https://x.com/orlitany/status/2113334247343751647?s=20}
}

@misc{rotstein2026jointscameraactioncogenerating,
  title = {Joints, Camera, Action! Co-Generating 3D Motion and Video for Arbitrary Rigs},
  author = {Noam Rotstein and Yoad Tewel and Chen Tessler and Haggai Maron and Gal Chechik and Or Litany and Yoni Kasten and Yuval Atzmon},
  year = {2026},
  venue = {Preprint},
  eprint = {2610.28632},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2610.28632},
  image = {./OL_files/jca_teaser.webp},
  paper = {https://arxiv.org/abs/2610.28632},
  page = {https://research.nvidia.com/labs/par/projects/jca/},
  tweet = {https://x.com/NoamRot/status/2112926067979702621?s=20}
}

@misc{keidar2026dyradradarnovelview,
  title = {DyRAD: Radar Novel View Synthesis for Dynamic Driving Scenes},
  author = {Merav Keidar and Tomer Borreda and Rajalakshmi Nandakumar and Or Litany},
  year = {2026},
  venue = {Preprint},
  eprint = {2609.39841},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2609.39841},
  image = {./OL_files/dyrad_teaser.webp},
  paper = {https://arxiv.org/abs/2609.39841},
  code = {https://github.com/Dyrad-NVS/DyRAD},
  page = {https://dyrad-nvs.github.io/},
  tweet = {https://x.com/orlitany/status/2106019515037610379?s=20}
}

@misc{green2026warphammerdensifyingscenewarps,
  title = {WarpHammer: Densifying Scene Warps with 3D Object Priors for Extreme View Synthesis},
  author = {Michael Green and Gavriel Habib and Dvir Samuel and Tal {Berkovitz Shalev} and Issar Tzachor and Rami Ben-Ari and Or Litany},
  year = {2026},
  venue = {Preprint},
  eprint = {2606.31258},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2606.31258},
  image = {./OL_files/warphammer_teaser.mp4},
  paper = {https://arxiv.org/abs/2606.31258},
  page = {https://pihash2k.github.io/extreme_nvs/}
}

@misc{gilo2026flowbenderfeedbackawaretrainingselfcorrecting,
  title = {FlowBender: Feedback-Aware Training for Self-Correcting Conditional Flows},
  author = {Daniel Gilo and Sven Elflein and Ido Sobol and Or Litany},
  year = {2026},
  venue = {Preprint},
  eprint = {2606.20404},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2606.20404},
  image = {./OL_files/teaser_flowbender.jpg},
  paper = {https://arxiv.org/abs/2606.20404},
  page = {https://flow-bender.github.io/},
  tweet = {https://x.com/danielgilo1/status/2067986128766951885?s=20}
}

@misc{maillard2026sceneteract,
  title = {{SceneTeract: Agentic Functional Affordances and VLM Grounding in 3D Scenes}},
  author = {Maillard, L{\'e}opold and Engelmann, Francis and Durand, Tom and Pan, Boxiao and You, Yang and Litany, Or and Guibas, Leonidas and Ovsjanikov, Maks},
  year = {2026},
  venue = {Preprint},
  eprint = {2603.29798},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2603.29798},
  image = {./OL_files/teaser_sceneteract.jpg},
  paper = {https://arxiv.org/abs/2603.29798},
  page = {https://sceneteract.github.io/}
}

@misc{rimon2026spectralsplatsrobustdifferentiabletracking,
  title = {SpectralSplats: Robust Differentiable Tracking via Spectral Moment Supervision},
  author = {Avigail {Cohen Rimon} and Amir Mann and Mirela Ben-Chen and Or Litany},
  year = {2026},
  venue = {ECCV 2026},
  eprint = {2603.24036},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2603.24036},
  image = {./OL_files/spectralsplats_teaser.mp4},
  paper = {https://arxiv.org/abs/2603.24036},
  page = {https://avigailco.github.io/SpectralSplats/},
  tweet = {https://x.com/orlitany/status/2037133567910674747}
}

@misc{borreda2025radargenautomotiveradarpoint,
  title = {RadarGen: Automotive Radar Point Cloud Generation from Cameras},
  author = {Tomer Borreda and Fangqiang Ding and Sanja Fidler and Shengyu Huang and Or Litany},
  year = {2025},
  venue = {ECCV 2026},
  eprint = {2512.17897},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2512.17897},
  image = {./OL_files/radargen_teaser.jpg},
  paper = {https://arxiv.org/abs/2512.17897},
  page = {https://radargen.github.io/},
  video = {https://www.youtube.com/watch?v=-g4zf8DzJDo},
  tweet = {https://x.com/TomerBorreda/status/2002974157911593179}
}

@misc{levy2026retrievalaugmentedgaussianavatarsimproving,
  title = {Retrieval-Augmented Gaussian Avatars: Improving Expression Generalization},
  author = {Matan Levy and Gavriel Habib and Issar Tzachor and Dvir Samuel and Rami Ben-Ari and Nir Darshan and Or Litany and Dani Lischinski},
  year = {2026},
  venue = {ECCV 2026 Workshop on Interactive Social Avatars (ISA)},
  eprint = {2603.08645},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2603.08645},
  image = {./OL_files/teaser_RAGaussianAvaters.jpg},
  paper = {https://arxiv.org/abs/2603.08645}
}

@misc{sella2026proxefinegrained3dshape,
  title = {Prox-E: Fine-Grained 3D Shape Editing via Primitive-Based Abstractions},
  author = {Etai Sella and Hao Phung and Nitay Amiel and Or Litany and Or Patashnik and Hadar Averbuch-Elor},
  year = {2026},
  venue = {SIGGRAPH 2026},
  eprint = {2604.23774},
  archiveprefix = {arXiv},
  primaryclass = {cs.GR},
  url = {https://arxiv.org/abs/2604.23774},
  image = {./OL_files/teaser_proxe.png},
  paper = {https://arxiv.org/abs/2604.23774},
  page = {https://etaisella.github.io/Prox-E/},
  tweet = {https://x.com/etai_sella/status/2051284611552936127?s=20}
}

@misc{liu2026testtimetrainingkvbinding,
  title = {Test-Time Training with KV Binding Is Secretly Linear Attention},
  author = {Junchen Liu and Sven Elflein and Or Litany and Zan Gojcic and Ruilong Li},
  year = {2026},
  venue = {ICML 2026},
  eprint = {2602.21204},
  archiveprefix = {arXiv},
  primaryclass = {cs.LG},
  url = {https://arxiv.org/abs/2602.21204},
  image = {./OL_files/tttlinear_teaser.jpg},
  paper = {https://arxiv.org/abs/2602.21204},
  page = {https://research.nvidia.com/labs/sil/projects/tttla/},
  tweet = {https://x.com/JunchenLiu77/status/2026665572755198224}
}

@inproceedings{sobol2026realiz3d,
  title = {{Realiz3D}: {3D} Generation Made Photorealistic via Domain-Aware Learning},
  author = {Ido Sobol and Kihyuk Sohn and Yoav Blum and Egor Zakharov and Max Bluvstein and Andrea Vedaldi and Or Litany},
  year = {2026},
  venue = {CVPR 2026},
  booktitle = {Proceedings of the {IEEE}/CVF Conference on Computer Vision and Pattern Recognition ({CVPR})},
  image = {./OL_files/realiz3d_teaser.jpg},
  paper = {https://idosobol.github.io/realiz3d/realiz3d_paper.pdf},
  page = {https://idosobol.github.io/realiz3d/},
  tweet = {https://x.com/IdoSobol/status/2040039788103754206?s=20}
}

@misc{gilo2025instructmix2mixconsistentsparseviewediting,
  title = {InstructMix2Mix: Consistent Sparse-View Editing Through Multi-View Model Personalization},
  author = {Daniel Gilo and Or Litany},
  year = {2025},
  venue = {CVPR 2026},
  eprint = {2511.14899},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2511.14899},
  image = {./OL_files/teaser_IM2M.png},
  paper = {https://www.arxiv.org/abs/2511.14899},
  page = {https://danielgilo.github.io/instruct-mix2mix/},
  code = {https://github.com/DanielGilo/instruct-mix2mix/tree/main},
  tweet = {https://x.com/orlitany/status/2026628621968789738?s=20}
}

@article{zhang2026diffusionharmonizer,
  title = {DiffusionHarmonizer: Bridging Neural Reconstruction and Photorealistic Simulation with Online Diffusion Enhancer},
  author = {Zhang, Yuxuan and T{\'o}thov{\'a}, Katar{\'\i}na and Wang, Zian and Yin, Kangxue and Turki, Haithem and de Lutio, Riccardo and Chang, Yen-Yu and Litany, Or and Fidler, Sanja and Gojcic, Zan},
  year = {2026},
  venue = {CVPR 2026},
  journal = {arXiv preprint arXiv:2602.24096},
  image = {./OL_files/harmonizer_teaser.gif},
  paper = {https://arxiv.org/abs/2602.24096},
  page = {https://research.nvidia.com/labs/sil/projects/diffusion-harmonizer/}
}

@misc{singer2025timetomovetrainingfreemotioncontrolled,
  title = {Time-to-Move: Training-Free Motion Controlled Video Generation via Dual-Clock Denoising},
  author = {Assaf Singer and Noam Rotstein and Amir Mann and Ron Kimmel and Or Litany},
  year = {2025},
  venue = {ICLR 2026},
  eprint = {2511.08633},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2511.08633},
  image = {./OL_files/teaser_T2M.png},
  paper = {https://arxiv.org/abs/2511.08633},
  page = {https://time-to-move.github.io/},
  code = {https://github.com/time-to-move/TTM},
  tweet = {https://x.com/assaf_singer/status/1988967522033647618}
}

@misc{fedele2025spacecontrolintroducingtesttimespatial,
  title = {SpaceControl: Introducing Test-Time Spatial Control to 3D Generative Modeling},
  author = {Elisabetta Fedele and Francis Engelmann and Ian Huang and Or Litany and Marc Pollefeys and Leonidas Guibas},
  year = {2025},
  venue = {ICLR 2026},
  eprint = {2512.05343},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2512.05343},
  image = {./OL_files/teaser_supergen.png},
  paper = {https://arxiv.org/abs/2512.05343},
  page = {https://spacecontrol3d.github.io/},
  code = {https://github.com/spacecontrol3d/spacecontrol},
  tweet = {https://x.com/efedele16/status/1997978439719305725}
}

@misc{stern2025appreciateviewtaskawareevaluation,
  title = {Appreciate the View: A Task-Aware Evaluation Framework for Novel View Synthesis},
  author = {Saar Stern and Ido Sobol and Or Litany},
  year = {2025},
  venue = {3DV 2026},
  eprint = {2511.12675},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2511.12675},
  image = {./OL_files/teaser_AppreciatetheView.png},
  paper = {https://arxiv.org/abs/2511.12675},
  page = {https://saarst.github.io/appreciate-the-view-website/},
  code = {https://github.com/saarst/appreciate-the-view},
  tweet = {https://x.com/SternSaar/status/1991622794925469952}
}

@misc{bekor2025gaussianseegaussiando,
  title = {Gaussian See, Gaussian Do: Semantic 3D Motion Transfer from Multiview Video},
  author = {Yarin Bekor and Gal Michael Harari and Or Perel and Or Litany},
  year = {2025},
  venue = {SIGGRAPH-ASIA 2025},
  eprint = {2511.14848},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2511.14848},
  image = {./OL_files/GSGD_teaser.jpg},
  paper = {https://arxiv.org/pdf/2511.14848},
  page = {https://gsgd-motiontransfer.github.io/}
}

@article{peng2024lessonsplatsteacherguideddiffusion,
  title = {A Lesson in Splats: Teacher-Guided Diffusion for 3D Gaussian Splats Generation with 2D Supervision},
  author = {Chensheng Peng and Ido Sobol and Masayoshi Tomizuka and Kurt Keutzer and Chenfeng Xu and Or Litany},
  year = {2025},
  venue = {ICCV 2025},
  journal = {ICCV},
  url = {https://arxiv.org/abs/2412.00623},
  image = {./OL_files/lessonInSplats.png},
  paper = {https://arxiv.org/abs/2412.00623},
  page = {https://lesson-in-splats.github.io/}
}

@article{collorone2025monster,
  title = {MonSTeR: a Unified Model for Motion, Scene, Text Retrieval},
  author = {Collorone, Luca and Gioia, Matteo and Pappa, Massimiliano and Leoni, Paolo and Ficarra, Giovanni and Litany, Or and Spinelli, Indro and Galasso, Fabio},
  year = {2025},
  venue = {ICCV 2025},
  journal = {ICCV},
  image = {./OL_files/monster_teaser.jpg},
  paper = {https://arxiv.org/abs/2510.03200},
  code = {https://github.com/colloroneluca/MonSTeR?tab=readme-ov-file},
  tweet = {https://x.com/IndroSpinelli/status/1940445067959038357}
}

@article{rimon2025fridu,
  title = {FRIDU: Functional Map Refinement with Guided Image Diffusion},
  author = {{Cohen Rimon}, Avigail and Ben-Chen, Mirela and Litany, Or},
  year = {2025},
  venue = {SGP 2025},
  journal = {SGP},
  image = {./OL_files/FRIDU_teaser.jpg},
  paper = {https://arxiv.org/abs/2506.14322},
  code = {https://github.com/avigailco/FRIDU}
}

@article{chen2024omnire,
  title = {OmniRe: Omni Urban Scene Reconstruction},
  author = {Ziyu Chen and Jiawei Yang and Jiahui Huang and Riccardo de Lutio and Janick {Martinez Esturo} and Boris Ivanovic and Or Litany and Zan Gojcic and Sanja Fidler and Marco Pavone and Li Song and Yue Wang},
  year = {2024},
  venue = {ICLR 2025},
  journal = {arXiv preprint arXiv:2408.16760},
  image = {./OL_files/omnire.png},
  paper = {https://arxiv.org/abs/2408.16760},
  page = {https://ziyc.github.io/omnire/},
  award = {Spotlight}
}

@misc{vu2025gasnerfgeometryawarestylizationdynamic,
  title = {GAS-NeRF: Geometry-Aware Stylization of Dynamic Radiance Fields},
  author = {Nhat Phuong Anh Vu and Abhishek Saroha and Or Litany and Daniel Cremers},
  year = {2025},
  venue = {Preprint},
  eprint = {2503.08483},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2503.08483},
  image = {./OL_files/GASnerf_teaser.png},
  paper = {https://arxiv.org/abs/2503.08483}
}

@misc{saroha2025zdysszeroshotdynamic,
  title = {ZDySS -- Zero-Shot Dynamic Scene Stylization using Gaussian Splatting},
  author = {Abhishek Saroha and Florian Hofherr and Mariia Gladkova and Cecilia Curreli and Or Litany and Daniel Cremers},
  year = {2025},
  venue = {Preprint},
  eprint = {2501.03875},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  url = {https://arxiv.org/abs/2501.03875},
  image = {./OL_files/teaser_zdyss.png},
  paper = {https://arxiv.org/abs/2501.03875}
}

@article{gilo2024epi,
  title = {Epi-NAF: Enhancing Neural Attenuation Fields for Limited-Angle CT with Epipolar Consistency Conditions},
  author = {Gilo, Daniel and Klinghoffer, Tzofi and Litany, Or},
  year = {2024},
  venue = {ISBI 2025},
  journal = {arXiv preprint arXiv:2411.06181},
  image = {./OL_files/epinaf_teaser.png},
  paper = {https://arxiv.org/abs/2411.06181v1},
  award = {Oral}
}

@misc{borreda2024rehublinearcomplexitygraph,
  title = {ReHub: Linear Complexity Graph Transformers with Adaptive Hub-Spoke Reassignment},
  author = {Tomer Borreda and Daniel Freedman and Or Litany},
  year = {2024},
  venue = {TMLR},
  eprint = {2412.01519},
  archiveprefix = {arXiv},
  primaryclass = {cs.LG},
  url = {https://arxiv.org/abs/2412.01519},
  image = {./OL_files/rehub.png},
  paper = {https://arxiv.org/abs/2412.01519},
  page = {https://tomerborreda.github.io/rehub/}
}

@article{je2024robustlangsym,
  title = {Robust Symmetry Detection via Riemannian Langevin Dynamics},
  author = {Jihyeon Je and Jiayi Liu and Guandao Yang and Boyang Deng and Shengqu Cai and Gordon Wetzstein and Or Litany and Leonidas Guibas},
  year = {2024},
  venue = {SIGGRAPH-ASIA 2024},
  journal = {ACM Trans. Graph.},
  eprint = {arXiv:2410.02786},
  doi = {10.1145/3680528.3687682},
  image = {./OL_files/symmetry_teaser.jpg},
  paper = {https://arxiv.org/abs/2410.02786},
  page = {https://symmetry-langevin.github.io/}
}

@misc{sobol2024zerotohero,
  title = {Zero-to-Hero: Enhancing Zero-Shot Novel View Synthesis via Attention Map Filtering},
  author = {Ido Sobol and Chenfeng Xu and Or Litany},
  year = {2024},
  venue = {NeurIPS 2024},
  journal = {NeurIPS},
  image = {./OL_files/zero2hero.jpg},
  paper = {https://arxiv.org/abs/2405.18677},
  page = {https://zero2hero-nvs.github.io/},
  tweet = {https://x.com/orlitany/status/1840155773029986480}
}

@misc{zhou2024nerfect,
  title = {The NeRFect Match: Exploring NeRF Features for Visual Localization},
  author = {Qunjie Zhou and Maxim Maximov and Or Litany and Laura Leal-Taixé},
  year = {2024},
  venue = {ECCV 2024},
  journal = {ECCV},
  image = {./OL_files/nerfmatch_teaser.jpg},
  paper = {https://arxiv.org/abs/2403.09577},
  page = {https://nerfmatch.github.io/}
}

@inproceedings{Wu2023dynfl,
  title = {Dynamic LiDAR Re-simulation using Compositional Neural Fields},
  author = {Wu, Hanfeng and Zuo, Xingxing and Leutenegger, Stefan and Litany, Or and Schindler, Konrad and Huang, Shengyu},
  year = {2024},
  venue = {CVPR 2024},
  booktitle = {The IEEE Conference on Computer Vision and Pattern Recognition (CVPR)},
  image = {./OL_files/dynfl_teaser.png},
  paper = {https://arxiv.org/abs/2312.05247},
  page = {https://shengyuh.github.io/dynfl/index.html}
}

@article{xu20233difftection,
  title = {3DiffTection: 3D Object Detection with Geometry-Aware Diffusion Features},
  author = {Chenfeng Xu and Huan Ling and Sanja Fidler and Or Litany},
  year = {2023},
  venue = {CVPR 2024},
  journal = {CVPR},
  image = {./OL_files/3difftection.png},
  paper = {https://arxiv.org/abs/2311.04391},
  page = {https://research.nvidia.com/labs/toronto-ai/3difftection/}
}

@misc{rozenberszki2023unscene3d,
  title = {UnScene3D: Unsupervised 3D Instance Segmentation for Indoor Scenes},
  author = {David Rozenberszki and Or Litany and Angela Dai},
  year = {2023},
  venue = {CVPR 2024},
  journal = {arXiv preprint arXiv:2303.14541},
  image = {./OL_files/unscene3d_teaser.jpeg},
  paper = {https://arxiv.org/abs/2303.14541},
  page = {https://rozdavid.github.io/unscene3d}
}

@article{atzmon2024approximately,
  title = {Approximately Piecewise {E(3)} Equivariant Point Networks},
  author = {Atzmon, Matan and Huang, Jiahui and Williams, Francis and Litany, Or},
  year = {2024},
  venue = {ICLR 2024},
  journal = {ICLR},
  image = {./OL_files/APEN_teaser.jpg},
  paper = {https://arxiv.org/abs/2402.08529}
}

@article{yang2023emernerf,
  title = {EmerNeRF: Emergent Spatial-Temporal Scene Decomposition via Self-Supervision},
  author = {Jiawei Yang and Boris Ivanovic and Or Litany and Xinshuo Weng and Seung Wook Kim and Boyi Li and Tong Che and Danfei Xu and Sanja Fidler and Marco Pavone and Yue Wang},
  year = {2023},
  venue = {ICLR 2024},
  journal = {arXiv preprint arXiv:2311.02077},
  image = {./OL_files/emerf_overview.png},
  paper = {https://arxiv.org/abs/2311.02077},
  page = {https://emernerf.github.io/}
}

@article{petrovich24stmc,
  title = {{STMC}: Multi-Track Timeline Control for Text-Driven 3D Human Motion Generation},
  author = {Petrovich, Mathis and Litany, Or and Iqbal, Umar and Black, Michael J. and Varol, G{\"u}l and Peng, Xue Bin and Rempe, Davis},
  year = {2024},
  venue = {CVPR 2024 Workshop on Human Motion Generation},
  journal = {arXiv:2401.08559},
  image = {./OL_files/multitrack_teaser.png},
  paper = {https://arxiv.org/abs/2401.08559},
  page = {https://mathis.petrovich.fr/stmc/}
}

@article{kimhi2023semisupervised,
  title = {Semi-Supervised Semantic Segmentation via Marginal Contextual Information},
  author = {Moshe Kimhi and Shai Kimhi and Evgenii Zheltonozhskii and Or Litany and Chaim Baskin},
  year = {2023},
  venue = {TMLR},
  eprint = {2308.13900},
  archiveprefix = {arXiv},
  primaryclass = {cs.CV},
  image = {./OL_files/s4mc_teaser.png},
  paper = {https://arxiv.org/abs/2308.13900},
  page = {https://s4mcontext.github.io/}
}

@article{Huang2023nfl,
  title = {Neural LiDAR Fields for Novel View Synthesis},
  author = {Huang, Shengyu and Gojcic, Zan and Wang, Zian and Williams, Francis and Kasten, Yoni and Fidler, Sanja and Schindler, Konrad and Litany, Or},
  year = {2023},
  venue = {ICCV 2023},
  journal = {arXiv preprint},
  image = {./OL_files/nfl_teaser.png},
  paper = {https://arxiv.org/abs/2305.01643},
  page = {https://research.nvidia.com/labs/toronto-ai/nfl/}
}

@article{tzofi2023view,
  title = {Towards Viewpoint Robustness in Bird’s Eye View Segmentation},
  author = {Klinghoffer, Tzofi and Philion, Jonah and Chen, Wenzheng and Litany, Or and Gojcic, Zan and Joo, Jungseock and Raskar, Ramesh and Fidler, Sanja and Alvarez, Jose},
  year = {2023},
  venue = {ICCV 2023},
  journal = {ICCV},
  image = {./OL_files/viewrobust_teaser.jpg},
  paper = {https://arxiv.org/pdf/2309.05192.pdf},
  page = {https://nvlabs.github.io/viewpoint-robustness/},
  talk = {https://youtu.be/CuJ9gfJpfhc}
}

@article{Huang2023nksr,
  title = {Neural Kernel Surface Reconstruction},
  author = {Huang, Jiahui and Gojcic, Zan and Atzmon, Matan and Litany, Or and Fidler, Sanja and Williams, Francis},
  year = {2023},
  venue = {CVPR 2023},
  journal = {CVPR},
  image = {./OL_files/nksr_teaser.jpg},
  paper = {https://arxiv.org/pdf/2305.19590.pdf},
  page = {https://research.nvidia.com/labs/toronto-ai/NKSR/},
  code = {https://github.com/nv-tlabs/nksr},
  award = {Highlight (top 10% of accepted papers)}
}

@inproceedings{rempeluo2023tracepace,
  title = {Trace and Pace: Controllable Pedestrian Animation via Guided Trajectory Diffusion},
  author = {Rempe, Davis and Luo, Zhengyi and Peng, Xue Bin and Yuan, Ye and Kitani, Kris and Kreis, Karsten and Fidler, Sanja and Litany, Or},
  year = {2023},
  venue = {CVPR 2023},
  booktitle = {Conference on Computer Vision and Pattern Recognition (CVPR)},
  image = {./OL_files/trace_pace_teaser.png},
  paper = {https://nv-tlabs.github.io/trace-pace/docs/trace_and_pace.pdf},
  page = {https://nv-tlabs.github.io/trace-pace/}
}

@article{dong2023fast,
  title = {Fast Monocular Scene Reconstruction with Global-Sparse Local-Dense Grids},
  author = {Dong, Wei and Choy, Chris and Loop, Charles and Zhu, Yuke and Litany, Or and Anandkumar, Anima},
  year = {2023},
  venue = {CVPR 2023},
  journal = {CVPR},
  image = {./OL_files/fastmono_teaser.png},
  paper = {https://arxiv.org/abs/2305.13220},
  page = {https://research.nvidia.com/labs/toronto-ai/publication/2023_cvpr_monocular/},
  code = {https://dongwei.info/publication/ash-mono/}
}

@article{schult2023mask3d,
  title = {Mask3D for 3D Semantic Instance Segmentation},
  author = {Schult, Jonas and Engelmann, Francis and Hermans, Alexander and Litany, Or and Tang, Siyu and Leibe, Bastian},
  year = {2023},
  venue = {ICRA 2023},
  booktitle = {International Conference on Robotics and Automation (ICRA)},
  image = {./OL_files/mask3D.png},
  paper = {https://arxiv.org/abs/2210.03105},
  page = {https://jonasschult.github.io/Mask3D/},
  code = {https://github.com/JonasSchult/Mask3D}
}

@inproceedings{gao2022get3d,
  title = {{GET3D}: A Generative Model of High Quality {3D} Textured Shapes Learned from Images},
  author = {Gao, Jun and Shen, Tianchang and Wang, Zian and Chen, Wenzheng and Yin, Kangxue and Li, Daiqing and Litany, Or and Gojcic, Zan and Fidler, Sanja},
  year = {2022},
  venue = {NeurIPS 2022},
  booktitle = {Advances In Neural Information Processing Systems},
  image = {./OL_files/get3D_model.png},
  paper = {https://arxiv.org/abs/2209.11163},
  page = {https://nv-tlabs.github.io/GET3D/},
  code = {https://github.com/nv-tlabs/GET3D}
}

@article{zeng2022lion,
  title = {LION: Latent Point Diffusion Models for 3D Shape Generation},
  author = {Zeng, Xiaohui and Vahdat, Arash and Williams, Francis and Gojcic, Zan and Litany, Or and Fidler, Sanja and Kreis, Karsten},
  year = {2022},
  venue = {NeurIPS 2022},
  journal = {Advances in Neural Information Processing Systems (NeurIPS)},
  image = {./OL_files/lion_pipeline.jpeg},
  paper = {https://arxiv.org/abs/2210.06978},
  page = {https://nv-tlabs.github.io/LION/},
  code = {https://github.com/nv-tlabs/LION}
}

@article{rozenberszki2022language,
  title = {Language-Grounded Indoor 3D Semantic Segmentation in the Wild},
  author = {Rozenberszki, David and Litany, Or and Dai, Angela},
  year = {2022},
  venue = {ECCV 2022},
  journal = {ECCV},
  image = {./OL_files/scannet200_teaser.jpeg},
  paper = {https://arxiv.org/abs/2204.07761},
  page = {https://rozdavid.github.io/scannet200},
  code = {https://github.com/RozDavid/LanguageGroundedSemseg}
}

@article{sharma2022mvdecor,
  title = {MvDeCor: Multi-view Dense Correspondence Learning for Fine-grained 3D Segmentation},
  author = {Sharma, Gopal and Yin, Kangxue and Maji, Subhransu and Kalogerakis, Evangelos and Litany, Or and Fidler, Sanja},
  year = {2022},
  venue = {ECCV 2022},
  journal = {ECCV},
  image = {./OL_files/mvdecor_teaser.png},
  paper = {https://arxiv.org/abs/2208.08580},
  page = {https://nv-tlabs.github.io/MvDeCor/},
  code = {https://github.com/nv-tlabs/MvDeCor}
}

@inproceedings{liu2022learning,
  title = {Learning Smooth Neural Functions via {Lipschitz} Regularization},
  author = {Liu, Hsueh-Ti Derek and Williams, Francis and Jacobson, Alec and Fidler, Sanja and Litany, Or},
  year = {2022},
  venue = {SIGGRAPH 2022},
  booktitle = {ACM SIGGRAPH 2022 Conference Proceedings},
  pages = {1--13},
  image = {./OL_files/lipschitz_teaser.png},
  paper = {https://arxiv.org/abs/2202.08345},
  page = {https://nv-tlabs.github.io/lip-mlp/},
  code = {https://github.com/ml-for-gp/jaxgptoolbox/tree/main/demos/lipschitz_mlp}
}

@article{litany2022federated,
  title = {Federated Learning with Heterogeneous Architectures using Graph {HyperNetworks}},
  author = {Litany, Or and Maron, Haggai and Acuna, David and Kautz, Jan and Chechik, Gal and Fidler, Sanja},
  year = {2022},
  venue = {Preprint},
  journal = {arXiv preprint arXiv:2201.08459},
  image = {./OL_files/heterofl.png},
  paper = {https://arxiv.org/abs/2201.08459}
}

@inproceedings{moschella2022learning,
  title = {Learning Spectral Unions of Partial Deformable 3D Shapes},
  author = {Moschella, Luca and Melzi, Simone and Cosmo, Luca and Maggioli, Filippo and Litany, Or and Ovsjanikov, Maks and Guibas, Leonidas and Rodol{\`a}, Emanuele},
  year = {2022},
  venue = {Eurographics 2022},
  booktitle = {Computer Graphics Forum},
  volume = {41},
  pages = {407--417},
  image = {./OL_files/spectral_unions_teaser.png},
  paper = {https://arxiv.org/abs/2104.00514},
  number = {2}
}

@article{rempe2022generating,
  title = {Generating Useful Accident-Prone Driving Scenarios via a Learned Traffic Prior},
  author = {Rempe, Davis and Philion, Jonah and Guibas, Leonidas J. and Fidler, Sanja and Litany, Or},
  year = {2022},
  venue = {CVPR 2022},
  journal = {CVPR},
  image = {./OL_files/strive_teaser.png},
  paper = {https://arxiv.org/abs/2112.05077},
  page = {https://nv-tlabs.github.io/STRIVE/},
  code = {https://github.com/nv-tlabs/STRIVE}
}

@article{williams2021neural,
  title = {Neural Fields as Learnable Kernels for 3D Reconstruction},
  author = {Williams, Francis and Gojcic, Zan and Khamis, Sameh and Zorin, Denis and Bruna, Joan and Fidler, Sanja and Litany, Or},
  equalcontrib = {1, 2},
  year = {2022},
  venue = {CVPR 2022},
  journal = {CVPR},
  image = {./OL_files/NKF_teaser.png},
  paper = {https://arxiv.org/abs/2111.13674},
  page = {https://nv-tlabs.github.io/nkf/}
}

@inproceedings{xie2022neural,
  title = {Neural Fields in Visual Computing and Beyond},
  author = {Xie, Yiheng and Takikawa, Towaki and Saito, Shunsuke and Litany, Or and Yan, Shiqin and Khan, Numair and Tombari, Federico and Tompkin, James and Sitzmann, Vincent and Sridhar, Srinath},
  year = {2022},
  venue = {Eurographics 2022 STAR},
  booktitle = {Computer Graphics Forum},
  volume = {41},
  pages = {641--676},
  image = {./OL_files/neural_fields_review_teaser.png},
  paper = {https://arxiv.org/abs/2111.11426},
  page = {https://neuralfields.cs.brown.edu/},
  number = {2}
}

@article{zheltonozhskii2021contrast,
  title = {Contrast to Divide: Self-Supervised Pre-Training for Learning with Noisy Labels},
  author = {Zheltonozhskii, Evgenii and Baskin, Chaim and Mendelson, Avi and Bronstein, Alex M. and Litany, Or},
  year = {2021},
  venue = {WACV 2022},
  journal = {WACV 2022},
  image = {./OL_files/C2D_teaser.png},
  paper = {https://arxiv.org/abs/2103.13646}
}

@article{chen2021dib,
  title = {DIB-R++: Learning to Predict Lighting and Material with a Hybrid Differentiable Renderer},
  author = {Chen, Wenzheng and Litalien, Joey and Gao, Jun and Wang, Zian and Tsang, Clement Fuji and Khamis, Sameh and Litany, Or and Fidler, Sanja},
  year = {2021},
  venue = {NeurIPS 2021},
  journal = {Advances in Neural Information Processing Systems (NeurIPS)},
  image = {./OL_files/dibrplus_teaser.png},
  paper = {https://arxiv.org/abs/2111.00140},
  page = {https://nv-tlabs.github.io/DIBRPlus/}
}

@article{nekrasov2021mix3d,
  title = {Mix3D: Out-of-Context Data Augmentation for 3D Scenes},
  author = {Nekrasov, Alexey and Schult, Jonas and Litany, Or and Leibe, Bastian and Engelmann, Francis},
  year = {2021},
  venue = {3DV 2021},
  journal = {3DV 2021},
  image = {./OL_files/mix3d_teaser.png},
  paper = {https://arxiv.org/abs/2110.02210},
  page = {https://kumuji.github.io/mix3d/}
}

@article{zhang2021strobenet,
  title = {{StrobeNet}: Category-Level Multiview Reconstruction of Articulated Objects},
  author = {Zhang, Ge and Litany, Or and Sridhar, Srinath and Guibas, Leonidas},
  year = {2021},
  venue = {Preprint},
  journal = {arXiv preprint arXiv:2105.08016},
  image = {./OL_files/strobenet.png},
  paper = {https://arxiv.org/abs/2105.08016},
  page = {https://dzhange.github.io/StrobeNet/}
}

@article{deng2021vector,
  title = {Vector Neurons: A General Framework for {SO(3)}-Equivariant Networks},
  author = {Deng, Congyue and Litany, Or and Duan, Yueqi and Poulenard, Adrien and Tagliasacchi, Andrea and Guibas, Leonidas},
  year = {2021},
  venue = {ICCV 2021},
  journal = {ICCV 2021},
  image = {./OL_files/VNN_teaser.png},
  paper = {https://arxiv.org/abs/2104.12229}
}

@inproceedings{xia2021relmogen,
  title = {{ReLMoGen}: Integrating Motion Generation in Reinforcement Learning for Mobile Manipulation},
  author = {Xia, Fei and Li, Chengshu and Mart{\'\i}n-Mart{\'\i}n, Roberto and Litany, Or and Toshev, Alexander and Savarese, Silvio},
  year = {2021},
  venue = {ICRA 2021},
  booktitle = {2021 IEEE International Conference on Robotics and Automation (ICRA)},
  pages = {4583--4590},
  image = {./OL_files/relmogen_teaser.png},
  paper = {https://arxiv.org/abs/2008.07792},
  talk = {https://youtu.be/mTaJ9xQMiD0?t=2083},
  organization = {IEEE}
}

@article{gojcic2021weakly,
  title = {Weakly Supervised Learning of Rigid 3D Scene Flow},
  author = {Gojcic, Zan and Litany, Or and Wieser, Andreas and Guibas, Leonidas J. and Birdal, Tolga},
  year = {2021},
  venue = {CVPR 2021},
  journal = {CVPR 2021},
  image = {./OL_files/weakly_cvpr21.png},
  paper = {https://arxiv.org/abs/2102.08945},
  page = {https://3dsceneflow.github.io/}
}

@inproceedings{resnick2021causal,
  title = {Causal {BERT}: Improving Object Detection by Searching for Challenging Groups},
  author = {Resnick, Cinjon and Litany, Or and Kar, Amlan and Kreis, Karsten and Lucas, James and Cho, Kyunghyun and Fidler, Sanja},
  year = {2021},
  venue = {ICCV workshop},
  booktitle = {Proceedings of the IEEE/CVF International Conference on Computer Vision},
  pages = {2972--2981},
  image = {./OL_files/causal_scene_bert.jpeg},
  paper = {https://arxiv.org/abs/2202.03651}
}

@article{wang20203dioumatch,
  title = {3DIoUMatch: Leveraging IoU Prediction for Semi-Supervised 3D Object Detection},
  author = {Wang, He and Cong, Yezhen and Litany, Or and Gao, Yue and Guibas, Leonidas J.},
  equalcontrib = {1, 2},
  year = {2020},
  venue = {CVPR 2021},
  journal = {CVPR 2021},
  image = {./OL_files/3dioumatch.png},
  paper = {https://arxiv.org/abs/2012.04355},
  page = {https://thu17cyz.github.io/3DIoUMatch/}
}

@article{litany2020representation,
  title = {Representation Learning Through Latent Canonicalizations},
  author = {Litany, Or and Morcos, Ari and Sridhar, Srinath and Guibas, Leonidas and Hoffman, Judy},
  year = {2020},
  venue = {WACV 2021},
  journal = {WACV 2021},
  image = {./OL_files/canonicalizers.png},
  paper = {https://arxiv.org/abs/2002.11829},
  talk = {https://youtu.be/l1Dh4vHuYQ4}
}

@article{yang2020continuous,
  title = {Continuous Geodesic Convolutions for Learning on 3D Shapes},
  author = {Yang, Zhangsihao and Litany, Or and Birdal, Tolga and Sridhar, Srinath and Guibas, Leonidas},
  year = {2020},
  venue = {WACV 2021},
  journal = {WACV 2021},
  image = {./OL_files/contConv.png},
  paper = {https://arxiv.org/abs/2002.02506}
}

@article{williams2020human,
  title = {Human 3D keypoints via spatial uncertainty modeling},
  author = {Williams, Francis and Litany, Or and Sud, Avneesh and Swersky, Kevin and Tagliasacchi, Andrea},
  year = {2020},
  venue = {Preprint},
  journal = {arXiv preprint arXiv:2012.10518},
  image = {./OL_files/3d_keypoint_estimation.png},
  paper = {https://arxiv.org/abs/2012.10518}
}

@inproceedings{resnick2020learned,
  title = {Learned Equivariant Rendering without Transformation Supervision},
  author = {Resnick, Cinjon and Litany, Or and Larochelle, Hugo and Bruna, Joan and Cho, Kyunghyun},
  year = {2020},
  venue = {Neurips 2020 DiffCVGP workshop},
  booktitle = {Diffcvgp workshop http://montrealrobotics.ca/diffcvgp/},
  image = {./OL_files/equi_render.png},
  paper = {https://arxiv.org/abs/2011.05787v1}
}

@article{tulsiani2020object,
  title = {Object-Centric Multi-View Aggregation},
  author = {Tulsiani, Shubham and Litany, Or and Qi, Charles R. and Wang, He and Guibas, Leonidas J.},
  year = {2020},
  venue = {Preprint},
  journal = {arXiv preprint arXiv:2007.10300},
  image = {./OL_files/mva_teaser.png},
  paper = {http://arxiv.org/abs/2007.10300}
}

@inproceedings{xie2020pointcontrast,
  title = {PointContrast: Unsupervised Pre-training for 3D Point Cloud Understanding},
  author = {Xie, Saining and Gu, Jiatao and Guo, Demi and Qi, Charles R. and Guibas, Leonidas J. and Litany, Or},
  year = {2020},
  venue = {ECCV 2020},
  booktitle = {ECCV 2020 Spotlight},
  image = {./OL_files/pointContrast.png},
  paper = {https://arxiv.org/abs/2007.10985},
  award = {Spotlight}
}

@inproceedings{halimi2020towards,
  title = {Towards Precise Completion of Deformable Shapes},
  author = {Halimi, Oshri and Imanuel, Ido and Litany, Or and Trappolini, Giovanni and Rodol{\`a}, Emanuele and Guibas, Leonidas and Kimmel, Ron},
  year = {2020},
  venue = {ECCV 2020},
  booktitle = {Computer Vision--ECCV 2020: 16th European Conference, Glasgow, UK, August 23--28, 2020, Proceedings, Part XXIV 16},
  pages = {359--377},
  image = {./OL_files/theWhole.png},
  paper = {https://arxiv.org/abs/2001.09650},
  organization = {Springer International Publishing}
}

@inproceedings{maron2020learning,
  title = {On Learning Sets of Symmetric Elements},
  author = {Maron, Haggai and Litany, Or and Chechik, Gal and Fetaya, Ethan},
  year = {2020},
  venue = {ICML 2020},
  booktitle = {ICML 2020 -- Outstanding paper award},
  image = {./OL_files/dss_layer.png},
  paper = {https://arxiv.org/abs/2002.08599},
  award = {Outstanding Paper Award}
}

@inproceedings{qi2020imvotenet,
  title = {ImVoteNet: Boosting 3D Object Detection in Point Clouds with Image Votes},
  author = {Qi, Charles R. and Chen, Xinlei and Litany, Or and Guibas, Leonidas J.},
  year = {2020},
  venue = {CVPR 2020},
  booktitle = {CVPR 2020},
  image = {./OL_files/imvote.png},
  paper = {https://arxiv.org/abs/2001.10692},
  talk = {https://www.youtube.com/watch?v=xCnbvgMAg-Y}
}

@inproceedings{qi2019deep,
  title = {Deep Hough Voting for 3D Object Detection in Point Clouds},
  author = {Qi, Charles R. and Litany, Or and He, Kaiming and Guibas, Leonidas J.},
  year = {2019},
  venue = {ICCV, 2019},
  booktitle = {ICCV 2019 (Oral, Best Paper Nomination)},
  image = {./OL_files/DHV_teaser.png},
  paper = {https://arxiv.org/pdf/1904.09664.pdf},
  code = {https://github.com/facebookresearch/votenet},
  slides = {./OL_files/talks/deep_hough_voting.pdf},
  talk = {https://youtu.be/2ntDYowHbZs?t=4585},
  award = {Best Paper Nomination}
}

@article{monti2018dual,
  title = {Dual-primal graph convolutional networks},
  author = {Monti, Federico and Shchur, Oleksandr and Bojchevski, Aleksandar and Litany, Or and G{\"u}nnemann, Stephan and Bronstein, Michael M.},
  year = {2018},
  venue = {GEM workshop at ECML-PKDD, 2019},
  journal = {arXiv preprint arXiv:1806.00770},
  image = {./OL_files/dualprimal.png},
  paper = {https://arxiv.org/pdf/1806.00770.pdf},
  award = {Oral presentation}
}

@inproceedings{litany2019soseleto,
  title = {SOSELETO: A Unified Approach to Transfer Learning and Training with Noisy Labels},
  author = {Litany, Or and Freedman, Daniel},
  year = {2019},
  venue = {ICLR workshop on Learning from Limited Labeled Data, 2019},
  booktitle = {ICLR workshop on Learning from Limited Labeled Data (LLD) -- Best Paper Award},
  image = {./OL_files/soseleto.png},
  paper = {https://arxiv.org/pdf/1805.09622.pdf},
  code = {https://github.com/orlitany/SOSELETO},
  slides = {./OL_files/SOSELETO_presentation.pdf},
  poster = {./OL_files/SOSELETO_ICLR19_poster.pdf},
  talk = {https://slideslive.com/38915746},
  award = {Best Paper Award}
}

@inproceedings{halimi2019unsupervised,
  title = {Unsupervised Learning of Dense Shape Correspondence},
  author = {Halimi, Oshri and Litany, Or and Rodol{\`a}, Emanuele and Bronstein, Alex M. and Kimmel, Ron},
  year = {2019},
  venue = {Computer Vision and Pattern Recognition (CVPR), 2019},
  booktitle = {Proceedings of the IEEE/CVF Conference on Computer Vision and Pattern Recognition},
  pages = {4370--4379},
  image = {./OL_files/unsupervised_fmnet.png},
  paper = {https://arxiv.org/pdf/1812.02415.pdf},
  code = {https://github.com/OshriHalimi/unsupervised_learning_of_dense_shape_correspondence},
  talk = {https://www.linkedin.com/feed/update/urn:li:activity:6547910607310598144},
  award = {Oral presentation}
}

@inproceedings{litany2018deformable,
  title = {Deformable Shape Completion with Graph Convolutional Autoencoders},
  author = {Litany, Or and Bronstein, Alex and Bronstein, Michael and Makadia, Ameesh},
  year = {2018},
  venue = {Computer Vision and Pattern Recognition (CVPR), 2018},
  booktitle = {Proceedings of the IEEE conference on computer vision and pattern recognition},
  pages = {1886--1895},
  image = {./OL_files/shapeComp.png},
  paper = {https://arxiv.org/pdf/1712.00268v1.pdf}
}

@incollection{litany2018partial,
  title = {Partial Single-and Multishape Dense Correspondence Using Functional Maps},
  author = {Litany, Or and Rodol{\`a}, Emanuele and Bronstein, Alex and Bronstein, Michael and Cremers, Daniel},
  year = {2018},
  venue = {Handbook of Numerical Analysis, Elsevier, 2018},
  booktitle = {Handbook of Numerical Analysis},
  publisher = {Elsevier},
  volume = {19},
  pages = {55--90},
  image = {./OL_files/pfm_book.png},
  paper = {https://www.sciencedirect.com/science/article/pii/S1570865918300097}
}

@article{remez2018class,
  title = {Class-Aware Fully Convolutional {Gaussian} and {Poisson} Denoising},
  author = {Remez, Tal and Litany, Or and Giryes, Raja and Bronstein, Alex M.},
  year = {2018},
  venue = {IEEE Transactions on Image Processing, 2018},
  journal = {IEEE Transactions on Image Processing},
  publisher = {IEEE},
  volume = {27},
  pages = {5707--5722},
  image = {./OL_files/class_aware_poiss.png},
  paper = {https://arxiv.org/pdf/1808.06562.pdf},
  code = {https://github.com/TalRemez/deep_class_aware_denoising},
  number = {11}
}

@article{lahner2017efficient,
  title = {Efficient Deformable Shape Correspondence via Kernel Matching},
  author = {L{\"a}hner, Zorah and Vestner, Matthias and Boyarski, Amit and Litany, Or and Slossberg, Ron and Remez, Tal and Rodol{\`a}, Emanuele and Bronstein, Alex and Bronstein, Michael and Kimmel, Ron and Cremers, Daniel},
  year = {2017},
  venue = {Intl. Conference on 3D Vision (3DV), 2017},
  journal = {3DV},
  image = {./OL_files/vestner-3dv17.png},
  paper = {https://arxiv.org/pdf/1707.08991.pdf},
  code = {https://github.com/zorah/KernelMatching}
}

@inproceedings{litany2017deep,
  title = {Deep Functional Maps: Structured Prediction for Dense Shape Correspondence},
  author = {Litany, Or and Remez, Tal and Rodol{\`a}, Emanuele and Bronstein, Alex and Bronstein, Michael},
  year = {2017},
  venue = {ICCV, 2017},
  booktitle = {Proceedings of the IEEE international conference on computer vision},
  pages = {5659--5667},
  image = {./OL_files/FMNet.png},
  paper = {http://vision.in.tum.de/_media/spezial/bib/litany-iccv17.pdf},
  code = {https://github.com/orlitany/DeepFunctionalMaps}
}

@inproceedings{remez2017deep,
  title = {Deep Class-Aware Image Denoising},
  author = {Remez, Tal and Litany, Or and Giryes, Raja and Bronstein, Alex M.},
  year = {2017},
  venue = {IEEE International Conference on Image Processing (ICIP), 2017},
  booktitle = {2017 international conference on sampling theory and applications (SampTA)},
  pages = {138--142},
  image = {./OL_files/clsawrden.png},
  paper = {https://arxiv.org/abs/1701.01698},
  code = {https://github.com/TalRemez/deep_class_aware_denoising},
  organization = {IEEE}
}

@article{litany2017cloud,
  title = {Cloud Dictionary: Sparse Coding and Modeling for Point Clouds},
  author = {Litany, Or and Remez, Tal and Bronstein, Alex},
  equalcontrib = {1, 2},
  year = {2017},
  venue = {Signal Processing with Adaptive Sparse Structured Representations (SPARS), 2017},
  journal = {SPARS},
  image = {./OL_files/clouddict.png},
  paper = {https://arxiv.org/pdf/1612.04956v1}
}

@inproceedings{litany2017fully,
  title = {Fully Spectral Partial Shape Matching},
  author = {Litany, Or and Rodol{\`a}, Emanuele and Bronstein, Alex M. and Bronstein, Michael M.},
  year = {2017},
  venue = {Computer Graphics Forum, Vol. 36(2), 2017},
  booktitle = {Computer Graphics Forum},
  volume = {36},
  image = {./OL_files/fullyspectral.png},
  paper = {http://vision.in.tum.de/_media/spezial/bib/litany-eg17.pdf},
  code = {https://github.com/orlitany/FSPM},
  award = {Presented at Eurographics, 2017},
  number = {2},
  organization = {The Eurographics Association and John Wiley \& Sons Ltd.}
}

@inproceedings{rodola2017shrec,
  title = {{SHREC}’17: Deformable Shape Retrieval with Missing Parts},
  author = {Rodol{\`a}, Emanuele and Cosmo, Luca and Litany, Or and Bronstein, Michael M. and Bronstein, Alex M. and others},
  year = {2017},
  venue = {EUROGRAPHICS Workshop on 3D Object Retrieval (3DOR), 2017},
  booktitle = {Proceedings of the Eurographics Workshop on 3D Object Retrieval, Lisbon, Portugal},
  pages = {23--24},
  image = {./OL_files/shrec17.png},
  paper = {http://vision.in.tum.de/_media/spezial/bib/shrec17partial.pdf},
  code = {http://vision.in.tum.de/_media/spezial/bib/shrec17-baseline.zip},
  dataset = {https://sites.google.com/view/shrec17/}
}

@article{litany2017asist,
  title = {{ASIST}: Automatic Semantically Invariant Scene Transformation},
  author = {Litany, Or and Remez, Tal and Freedman, Daniel and Shapira, Lior and Bronstein, Alex and Gal, Ran},
  year = {2017},
  venue = {Computer Vision and Image Understanding (CVIU), 2017},
  journal = {Computer Vision and Image Understanding},
  publisher = {Academic Press},
  volume = {157},
  pages = {284--299},
  image = {./OL_files/asist.png},
  paper = {http://arxiv.org/abs/1512.01515}
}

@inproceedings{litany2016non,
  title = {Non-Rigid Puzzles},
  author = {Litany, Or and Rodol{\`a}, Emanuele and Bronstein, Alex and Bronstein, Michael and Cremers, Daniel},
  year = {2016},
  venue = {Computer Graphics Forum, Wiley, volume 35, 2016},
  booktitle = {Computer Graphics Forum},
  volume = {35},
  pages = {135--143},
  image = {./OL_files/puzzles.png},
  paper = {http://vision.in.tum.de/_media/spezial/bib/litany16.pdf},
  code = {https://github.com/orlitany/NonRigidPuzzles},
  award = {SGP Best Paper Award},
  number = {5},
  organization = {The Eurographics Association and John Wiley \& Sons Ltd.}
}

@inproceedings{remez2016picture,
  title = {A picture is worth a billion bits: Real-time image reconstruction from dense binary threshold pixels},
  author = {Remez, Tal and Litany, Or and Bronstein, Alex},
  equalcontrib = {1, 2},
  year = {2016},
  venue = {International Conference on Computational Photography (ICCP), 2016},
  booktitle = {2016 IEEE International Conference on Computational Photography (ICCP)},
  pages = {1--9},
  image = {./OL_files/binarycam.png},
  paper = {https://arxiv.org/pdf/1510.04601.pdf},
  organization = {IEEE}
}

@article{remez2016fpga,
  title = {FPGA system for real-time computational extended depth of field imaging using phase aperture coding},
  author = {Remez, Tal and Litany, Or and Yoseff, Shachar and Haim, Harel and Bronstein, Alex},
  year = {2016},
  venue = {Preprint},
  journal = {arXiv preprint arXiv:1608.01074},
  image = {./OL_files/fpga.png},
  paper = {https://arxiv.org/abs/1608.01074}
}

@misc{litany2015image,
  title = {Image reconstruction from dense binary pixels},
  author = {Or Litany and Tal Remez and Alex Bronstein},
  equalcontrib = {1, 2},
  year = {2015},
  venue = {Signal Processing with Adaptive Sparse Structured Representations (SPARS), 2015},
  archiveprefix = {arXiv preprint arXiv:1512.01774},
  image = {./OL_files/binarycamspars.png},
  paper = {http://arxiv.org/abs/1512.01774}
}

@inproceedings{litany2012putting,
  title = {Putting the Pieces Together: Regularized Multi-part Shape Matching},
  author = {Litany, Or and Bronstein, Alexander M. and Bronstein, Michael M.},
  year = {2012},
  venue = {Workshop on Nonrigid Shape Analysis and Deformable Image Alignment (NORDIA), 2012},
  booktitle = {ECCV Workshops (1)},
  pages = {1--11},
  image = {./OL_files/rigidpuzzles.png},
  paper = {https://vista.cs.technion.ac.il/wp-content/uploads/2018/10/LitBroBroNORDIA12.pdf}
}